Skip to main content

Table 2 Motif data information in MEME analysis of VvRCHCs

From: Identification of C3H2C3-type RING E3 ubiquitin ligase in grapevine and characterization of drought resistance function of VyRCHC114

Motifs Protein sequences Width
Motif1 LLPCGHAFHVDCIDKWLSSHNSCPLCR width=27
Motif2 SSILSLTPKLEKSSGGSGEDAECAICLEEFEEGEELR width=37
Motif3 MRLDVDNMSYEELLALGERIGNVSTGLS width=28
Motif4 GVCMGEYFCEKCKFFDDDTSKQQYHCDECGICRVGGRENFFHCKKCGCCY width=50
Motif5 HNHYHLVQGNYIGHPFQPSGNPWVDQQSGNNGSGGGTLAWNHGPALPYLH width=50
Motif6 FSPIMLIIJVILATAFLLVLLLHVYAR width=27
Motif7 CFFIFICHKLFPKIIPRSIMSNYIIPTAAHLTWAWDFLLHYSLFPNSHHN width=50
Motif8 GSNISGGSREAGNVGIQGYHDTSSGRSSTDYLQPPVLHRHHNLHYPPPPP width=50
Motif9 MQGARRHFHPQVVASSYRLATISSRSPVPPQVGVEAGHRHPGPVPPTWIR width=50
Motif10 YGCQHYRRRCRIRAPCCNEIFDCRHCHN width=28
Motif11 RLSSLVKHLKMALDCFFAVWFVIGNVWIFGGGS width=33
Motif12 SLSRHERPSAPLFAWIVGYALGCVLTLPILYWRYRRRN width=38