Skip to main content

Table 1 Comparison of the cytosolic tail sequence and transmembrane domain length of glucosidases I cloned from different species

From: Cytosolic N-terminal arginine-based signals together with a luminal signal target a type II membrane protein to the plant ER

Organism Cytosolic tail sequence TMD length
Arabidopsis thaliana
AJ278990
MTGASRRSARGRIKSSSLSPGSDEGSAYPPSIRRGKGKELVSIGAFKTNLK 18
Oryza sativa
BAB86175.1
MSGGGGSSSVRRPVAAARSRSGPEPDARRAAAAAAAAAAAAARRRGRGDHGPLRLMEVSPRN 23
Neurospora crassa
CAC18158.1
MAPPPPRQPRQ 23
Strongylocentrotus Purpuratus
XP_797552.1
>MAARTRIADSGGGARSRETKTKPKSGNGAQSRNNETQSSSKN 23
Danio rerio
XP_696318.1
MGRRRKRVATGDGVPSPRKEEKAPAPPRKEKKKKTDIGK 24
Apis melifera
XP_623340.1
MSILNISITVLCIAIATWFSYKGYLETRVNTPYDIKKLVTIS 23
Tribolium castaneum
XP_972740.1
MARQRRTQGAADPNKGTNSSSSNGSNSTNNRSSKSTS 23
Enchytraeus japonensis
BAE93517.1
MAKKKVPREKNHSGGTTRRTSESSSNNHADSKRQIRIKLNEKRKRQEPGSK 23
Caenorhabditis elegans
NP_502053.1
MHREHEEMHQPSRRRRPPREVERPSATIRYEPVAEPEPWCSFCSWD 23
Homo sapiens
NP_006293.2
MARGERRRRAVPAEGVRTAERAARGGPGRRDGRGGGPR 21
  -60 -50 -40 -30 -20 -10 -1  
  1. Numbers below the cytosolic tail sequences indicate the position from the transmembrane domain (TMD). Bold letters highlight the importance of arginine (R) and lysine (K) residues. Note underlined sequence from H. sapiens retains a reporter membrane protein in the ER in plant cell.