Skip to main content

Table 3 E-value and consensus sequences of 25 motifs identified in PtSPLs

From: Molecular characterization of the SPL gene family in Populus trichocarpa

Motif E-value Consensus sequence
1 1.0e-2549 CQVEGCNADLSSAKDYHRRHKVCEVHSKAPKVIVAGLEQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNERRRKPQPD
2 3.3e-516 SDQPSSSSSSGDAQCRTGRIVFKLFDKDPNDFPGTLRTQILDWLSHSTDMESYIRPGCIILTIYLAMPEAAWEELCCDLG
3 6.2e-387 LFRPDVAGPAGLTPLHIAACKDGSEDVLDALTEDPGEVGISAWKNARDATGFTPYARLRGHHSYIHLVQRKLADKRNGQVSVVI
4 3.6e-174 ASRSLLYRPAMLSMVAIAAVCVALLFKSCPEVLYV
5 9.0e-136 VEAGEETEFVVKGRNLYQPGTRLLCAVEGKYLVQETTQALMD
6 7.4e-135 FPLRRFKFLLEFSMDRDWCAVVRKLLDMLVEGNVCRD
7 5.6e-100 FWRTGWFYVRVQNQLAFHKNGQVVLDTSL
8 3.0e-085 GGSMNDDQGYLLTSILSNLHSNRSDQTKDQDLLSHLLRSLASHAGEHNGRNLFGLLQGPRGL
9 1.8e-095 EGMPSKEQALDFLNEIGWLLHRSDLKSRL
10 4.8e-088 SSLEALSEMGLLHRAVRRNSRKMVELLLR
11 7.4e-085 MEARFGGESHHFYAPVPSDLKAVGKRGLEWDLNDWKWDGDLFIASPLNPVPSDCRSRQFFPTGPGLGEKAGGNNSNSSCS
12 3.2e-077 STSLGASxSSGESLLGLKLGKRIYFEDAxGxNNxK
13 3.5e-070 FSIPNNFAAKSEEPEATAGQIKLNFDLNDIYDDSDDGIEDIERSHAPVNAGMGSFDCPLMVQQDSHKSSPPHTSGNSDS
14 1.3e-052 ASDSDCALSLLSSQS
15 8.9e-057 NFSCSxPNLLGRGFIEVED
16 9.8e-064 PFIIADADVCSEIRILEQEFD
17 8.7e-053 GERISSCNESPSEDSDSQGQDSRPNLPLQLFSSSPENESRPKVASSRKYFSSASSNPIEDRSPSSSP
18 1.8e-039 PFRWELLDYGT
19 5.1e-035 QHDGDMEIHLPPITTDWDWGDILDFAVDDQFPLSFDTPGDLTQPIDNPTPEIESQQLEAPVPDRVRKRDPRLTCSNFLAGIVPCACPEMDELLLEEEAALPGKKRVRVARAG
20 2.8e-033 DDWNLKAWDWDGDEFEA
21 8.5e-032 MDCNGKPHLQWDWENLIMFNAITTENSKK
22 2.7e-030 DEDNLGDEKGKRELEKRRRVVFIDDDNLND
23 3.3e-028 VNSARIFSNQGTRYLHFGSSQIFSTSAMNAAWTGAAKAERDPMLNTSQSSMNFDGRKNLFPGSLSPNYKEGKQFPFLQGTSSTIPGDSIHLDANSTLGNSQKMFSDGLNR
24 3.4e-027 KGRMRVYLNNMIFNVTKDGHSVMKVNVKGHAPRLHYVHPTC
25 5.9e-025 DERQQMSHAWDKAPLVHARPNANLTWEGTSISKFTITKDYIAKPAEIGGNDGQFHLPGFDLTNGIATQHHHKSN