Skip to main content

Table 2 Group and sub-group specific conserved motifs

From: Genome-wide analysis of the MYB transcription factor superfamily in soybean

Motif E-value Consensus sequences
1 3.60E-146 L[RK]MGIDPVTH[ST]PRLDLLD[IL]SSIL[NRS][SA]S[LFI][YG][NG]
2 1.80E-44 [AHY][ANS][NY][DS][SK]N[FY][DN]D[GD]M[DE]FW[YF]D[IV][FL][TAI][RKS][ST][GN][ED][SI]IEL[LPS]E
3 7.40E-32 [EP][ETD][INTV][MN][PAL][APV][IL]DE[SD]FWSE[VA][LAT][SIV][DS][DY][EN]
4 8.10E-13 [KD][PK][NP]xL[IL]EIP[FW][DE][LPS]D[HPY]D[FI]W[SK][FL][LI]D
5 2.20E-17 PKL[LF]F[SA]EWL
6 1.00E-90 [HIK][KV][AK][PS][SAE]S[PT]STRHM[AV]QWES[AV]R[LV]EAEARLS[RN]E
7 2.80E-58 [SY]W[NP][NT][NS]KT[DC][SP]D[HY]FL[RQ][IL]WNSEVG[EK][SA]FR[DMN][VI][HK][GK]
8 1.90E-27 D[TS][AS]L[QK][LH]LL[DH][FM]P[ID][NS][ND][DM]
9 7.60E-95 [RK]GQWERRLQTDI[NH]MAK[QKR]AL[SC]EALS[PL][DN]K[PA]
10 8.00E-64 [PT][TN][TP][TY][QP][ST][GMT][CTV]YASS[AT][DE]NIA[RK]LL[KQ][GN][WF]MK[ND][TS]PK
11 4.40E-31 [QD][GM][PS][FL]SL[FL]EKWL[FL]D[DE][QA][GAS][CGH]Q[EMQ]
12 1.20E-145 [KT]N[DE][AT]LLS[ST][DEL]G[QP]SK[DNT]AANLSHMAQWESARLEAEARL[VA]RESK[LI]
13 8.30E-22 [IT]T[SV]N[AV][GT][RV][SV][GQS][DQ]LESPTST[LV]S[FE][SN][EN]N[AV]P[MPS]
14 2.00E-48 [DN][LFY]YE[DE]N[KN]NYWN[SN]I[LF]NL[VM][ND][SY]S[PS]
15 3.70E-12 GIG[LP][EQ][KS]DNIRDPL[EV]PNLTSPSHS[IV]TSAKLLNKMATSLPHKV[HY]GLEA[AV]KAVFSKLME
16 3.60E-19 [FQ]VG[GS]CLNALSPFED[GK]PHI[ST]K[IT]IDSPS[GS]PTLMFN[HQ]VTTPSCFSEDNEDNWQCVSSNYVSF[KR][IN]CAA[NS]GG
17 5.40E-33 [LG][GM][AH]Q[APY][LV][VM]NPE[LFI]LKLA
18 4.10E-12 S[VE][LS][SV]TP[SL]S[ST]PTPLNS
19 2.90E-37 [YFIS][VNS][NG][SCG][SNT]TE[DE]ER[DE][STQ][YS][CYG][SD]
20 4.20E-22 [LQ]A[ELR][ALQ][QTV][EQ][LM]AKLQ[YCL][LF][QH][YQ]
21 1.40E-12 [NY][AGV][EG][DG][ANP][SC][ST][YI]W[PS][ED][LH]L[LF][ED]
22 2.30E-18 [EF][EL][MT]WGDFM[DY]EE
23 8.20E-18 KT[QL]VYLPKPIRVKA[ML][YS][LS][QC][RI][TP][DR]
24 7.30E-15 HG[TN]L[QE][QK]LYEEY[FL]QLLN[MV][DE][EHQ][GK][QP][FD]E[LR][ND]SFA[EQ]SLL
25 6.90E-36 [PYL][NG][HFNQ][DQT][NE][ND][LQV][QTE][TA][KN][PI][PK][VIM]QE[TA][LF]FS[SH][TK][CP]PLF[MI][FV]DT
26 1.70E-35 [FL][EG][SP][VN][NK][IM]G[VAL][EG]GD[FM][SYF][VL]P[PS]LE[SN][RV][ST][ICT][ET][SR][ND]
27 1.90E-55 [EIV][ELS]E[RP][CH][PH][DQ]LNL[ED]L[SRT]I[SG][PL]P[SRW]Q[PQ]Q
28 5.80E-38 ERCPDLNLEL[RT]ISPP[RW]QQQ
29 3.90E-21 CF[AV]C[SR][LF]G[LM]HN[SG][KM][DE]C[SR]
30 3.20E-29 [LF]DMK[GK]I[IM][ANS]LLE[DE][ND]NHRVP[SY]IS
31 2.00E-25 M[HY][APQ][NA][TC][ST][EP][ER][QK]GY[FL]Y[SN]M[FV][NI][PV][NF][CD]
32 5.40E-12 [WF][EG][LV][GMR][SK]SPYE[TN]RI[LS]DWI[AS]E[LI][QS][NT][GD][YQ][GS][ED][AKN][EN]L[ES][QE]D[CH][NS]S[TN][GS][TC][CS][NE][NY][YN]
33 8.80E-28 NYWS[MI][ED]DIWS[MS]
34 1.00E-46 W[TND][DV]E[NS][MFI][WLC][FL]LQQ
35 2.00E-37 [NS]SGLLD[AD]LLEEA[QEK]A[LM][SA]S[GS][KEG][NK]SK[KS][DR][KR]S
36 1.70E-36 GHRA[LW][AG][TD]HKKEAAWRL[SR]R[VL]ELQLESEK[TA][NC]R[RQ]REK[IM]EE[FI]EAK[IM]KAL[QR]EE[EQ][KL][AN]A[LM][GE][RK]IE[AG]EYREQL[ADV][AG]LRRDAE[NA]K[ED]QKLA
37 6.80E-20 [LV][FHY]RPV[AP]R[VLM][SG][AS]F[SN][VAI][YC][NHK]
38 5.20E-19 [CDY][CDGSY][ED][PQR][FIMQS][VI]P[SHQ][KQT]CG[HG]GC[CS]
39 7.10E-26 [EA][LF][IA][SA]I[AS][TN][DE][LI][NGS][NS][ILT]AW[IL][KR]SG[LK][ED]
40 1.70E-55 [ET]T[SA]SS[SE]DDP[PA]TSLSLSLPG[VAF]D
41 1.90E-124 F[SG][GA]EF[ML][AT]V[MV]QEMI[RK]KEVRSYM[SAE]x[ML][QE][QR][GN]NG
42 3.40E-33 [PKV][RG][PN][NS][IL]L[EQ][DN]YI[KR]S[IL][TNE][ILQ][NI]
43 2.50E-150 [RM][LV][SI]RVELQLESEK[AT][GN]RRREK[IM]EE[FI]EAKIKAL[QR]EE[EQ][TKL]AAL[DG]RIEAEYREQL[AD][AG]LRRDAE[NS]KEQKLAEQW[AD]AKHLR[LF]T[KR][FL]LEQ[LSV][GD][CT][RI]
44 4.10E-109 RIGMTPTRDGFSFSMTPKGTPLRD[AE]LHINEDMNMHDSTKLELQRQADMRRSLRSGLGSLPQPKNEYQIVM[PQ]PV[LP]EDAEEPEEKIEEDMSDRIAREKAEEEARQQALLRKRSKVLQRELPRPPTASLELIRNSLMRTD[GV]DKSSFVPPTSIEQADEMIRRELL[ST]LLEHDN[AG]KYPLD[DE]KVIKEKKKGAKRAVNGSAVPVIEDF[EQ]EDEMKEADKLIKEEALYLCAAMGHEDEPLDEFIEAHRTCLNDLMYFPTR
45 4.10E-171 A[QE]NNKIQGTFLKKDDPK[IV][NST]ALMQQAELLSSLA[LQ]KV[DN]A[ED]N[MT]DQS[LM]ENAWKVLQ[ED]FLN[RK][TS]KE[SN]D[IL][PF][RG][YQ][KG]IPD
46 1.00E-48 [LF]QLV[DE][LF]KDL[IL][EA]DL[KR]S[GS][NS]E[ED][GI]Q[AP][CS]WRQ[MPV][DE]L[YH
47 1.80E-123 [EK]FSSP[LI]QVTPLFRSLA[AD]GIPSPQFSESER[SN]FL[MRL]KTLG[MI]ES[PS]S[ILP][NC]PS[AV]N[PS]S[QK]PP[PL]CKR[AV]LL[IPH]
48 4.90E-79 GIDYNAEIPFEKR[PA]P[PA]GF[FY]D[VT][TA]DEDRP[VA][ED]Q[PV][QK]FPTTIEELEGKRR[VA]DVEA[QH]LRKQD[IV]A[KR]NKIAQRQDAP[SA]AIL[HQ]ANKLNDPE[TV]VRKRSKLMLPPPQISD[QH]
49 3.50E-92 KGDAIMMEAENLARLR[ED]SQTPLLGGENPELHPSDF[NST]GVTP[KR]KKEIQTPNPMLTPS[AM]TPG[GA]AGLTPRIG[ML]TP[TS]RDG[FS]SFSMTPKGTP[LF]RD[EA]LHINEDM[ND]MH
50 6.20E-59 I[ED]DF[DEQ]E[DN]E[ML][KQ]EADK[LM]IKEE[AG][LK][YF]LC[AV][AS]MGHE[DN][EK][PT]LD[ED]F[IV]EAH[RN]TC[LV]NDLMYFPTR[NS]AY[GE]LSSVAGN[MA][ED]K[LV][AT]A[LF]Q[NE]E[FM]ENVR