Skip to main content

Table 2 Functional domain analysis of the 36 Hsf proteins identified in Cucurbita moschata

From: Genome-wide characterization and expression analysis of the heat shock transcription factor family in pumpkin (Cucurbita moschata)

Subfamily Name Gene ID Gene Name Group DBD HR-A/B NLS NES AHA RD
Subfamily
I
CmoCh06G013840.1 CmHsf17 A 243–336 359–407 (428)QKDKHKELEEAINRKRRRHI nd DDGFWENLL nd
CmoCh14G017830.1 CmHsf29 A 42–135 162–205 (225)GFRKVDPDKWEFAHESFLRGQRHLLKLIRR IEELCLSL SDFWQKLIEL nd
CmoCh17G011810.1 CmHsf34 A 43–136 163–206 (243)ITRKRRRPIQ TELEALALEMQGL EGFWEELFSE nd
CmoCh19G000190.1 CmHsf36 A 79–172 198–242 (278)ATKKRRWPID LEALAMEM EGFWEEFFSE nd
CmoCh05G014000.1 CmHsf12 C 458–551 573–599 (1191)QRRPPVGPEDPKRSASGRHTGYVKNYD nd nd nd
CmoCh12G005810.1 CmHsf26 C 39–132 153–205 (236)RKRRLTASPSLENLQDETILAAVKQEQLE nd nd nd
CmoCh05G000960.1 CmHsf9 C 41–134 155–208 (236)EIGRKRRLTSS nd nd nd
CmoCh04G011130.1 CmHsf8 C 12–105 137–184 (323)IDHEKRSVDNEDDELDMETIDTRTHEEKSQD nd nd nd
CmoCh04G000850.1 CmHsf7 C 12–105 137–184 (369)RLDESYIEKSNTVNLMELMASDQEILYETPAKMQG nd nd nd
CmoCh05G013450.1 CmHsf11 A 53–146 162–195 (221)RRVRRRVTMRPPPSPVKFVKA VKREDDGELALEISKLKQEQI SNFWDDLLVQ nd
CmoCh13G006110.1 CmHsf24 A 11–104 124–172 (187)RFLHKPGLRLDLLPQLETSDRKRRLP LKRDKEQLLLELRKHEQ DVFWQQFLTE nd
CmoCh10G006520.1 CmHsf22 A 9–102 122–155 (189)PDKKRRFMTS nd EGFWEELFSE nd
CmoCh16G012250.1 CmHsf33 A 32–125 154–205 (236)EANKKRRLKQD MKVLLDEKLCLDNH SNFWDDLLVQ nd
CmoCh06G006450.1 CmHsf14 A 32–125 154–205 (236)EANKKRRLKQD LQDFELLIKQM SNFWNDLLVH nd
CmoCh06G004420.1 CmHsf13 A 968–1124 1144–1195 (1225)PRMKRKFVKQ LQLALALRL LSPFWDLGSL nd
CmoCh14G002670.1 CmHsf28 A 239–387 407–438 (474)FLLKRKKEPKDIDSERIKRKFVK nd DVFWEQFLTE nd
CmoCh02G000520.1 CmHsf2 A 11–104 117–155 (173)RMGNQQKQLIAIMAAELQKDQSRKRRK LSELERQELELKI DVFWEQFLTE nd
CmoCh11G006110.1 CmHsf27 A 11–104 117–155 nd LEEELEGM DVFWEQFLTE nd
CmoCh07G001570.1 CmHsf18 A 11–104 123–179 (205)HERKRRLATV LQLQMQL DVFWEQFLTE nd
CmoCh14G019680.1 CmHsf30 A 9–102 119–174 (201)FNKKRRLPS LQLQELTM DVFWEQFLTE nd
CmoCh06G012330.1 CmHsf16 A 14–107 124–179 (206)FNKKRRLPS IQLQDLTV DVFWEQFLTE nd
Subfamily
II
CmoCh03G012560.1 CmHsf6 C 276–391 320–352 (432)RRQKLELQAQIAQFKALHIRLLDCVGRRIEK nd nd nd
CmoCh07G002420.1 CmHsf19 C 8–120 147–178 (182)KTRNPAPFLSKTY nd nd nd
Subfamily
III
CmoCh09G002330.1 CmHsf21 B 21–114 117–155 (287)IHSKKRLHPEYASNNIGKENNNKARFV LEKDDLGLNL nd KLFGVAI
CmoCh01G018910.1 CmHsf1 B 120–213/21–114 117–156 (374)GSSKSFVTIVEEPKTKLFGVSLQSKKRVHPE VLEKDDLGLNL nd KLFGVSL
CmoCh05G001750.1 CmHsf10 B 21–114 117–157 (337)KKRQHPDTTNYVSTSSNVSDTNKNSRGS LLLLFKPRL nd KLFGVPL
CmoCh10G009220.1 CmHsf23 B 21–114 117–158 (273)RGKKRMHHE KQLLLAI nd KLFGVPI
CmoCh11G009050.1 CmHsf25 B 11–104 124–172 (221)RGKKRGASDEE nd nd KLFGVPI
CmoCh03G000560.1 CmHsf4 B 32–125 150–187 (197)GSRKEDEDERPKLFGVRLEVEGERRRKTKR nd nd KLFGVRL
CmoCh06G009230.1 CmHsf15 B 19–112 144–180 (196)EMMVMKPNLKLFGVKLEVGEEDEMVRQSKR LKLFGVKLEV nd KLFGVKL
CmCh07G007220.1 CmHsf20 B 6–99 144–183 (244)EKNNDKNKTKREEEEKVEVCGNEPEAKVMKT nd nd KLFGVWL
CmoCh03G009950.1 CmHsf5 B 6–99 150–188 (258)EKKKMKRVREEKIGCSNAPHAKAMK nd nd KLFGVWL
CmoCh02G015130.1 CmHsf3 B 21–114 177–207 (254)FLTKTYQLVDDPDVDDLISWNEDGSTFIVW nd nd KLFGVSI
CmoCh15G012680.1 CmHsf31 B 21–114 176–206 (279)IGVKRRREEE nd nd KLFGVSI
CmoCh16G001410.1 CmHsf32 B 19–112 134–173 nd LASAKSLDL nd KLFGVWL
CmoCh18G012590.1 CmHsf35 B 85–178 226–260 (269)ENQLKSSCKVRESVLASAKSLDLFPLKRRSEE LASAKSLDL nd KLFGVS
  1. Note: The amino acid sequences of Hsf in the table came from Cucurbit genomics database. DBD DNA-binding domain, HR-A/B Oligomerization domain, NLS Nuclear localization signal, NES Nuclear export signal, AHA Transcriptional activation domain, RD Repressor domain; nd No motifs detectable by sequence similarity search. For the NLS column, the numbers in parenthesis are the start site of the functional domain