Skip to main content

Table 4 Protein identification from SDS-PAGE bands in B. distachyon by MALDI-TOF-MS

From: Molecular characterization of LMW-GS genes in Brachypodium distachyon L. reveals highly conserved Glu-3 loci in Triticum and relatedspecies

LMW-GS Genes LMW-GS subunit Measured mass (M+H)+ Calculated mass (M+H)+ Missed cleavage Peptide sequences predicted by PeptideMass Positions
HQ220190 4-1 845.4112 842.4913 0 QTPEQSR 218-224
   1088.5128 1091.5411 0 QCCQQLR 211-217
   1704.7904 1707.8036 1 QCCQQLRQTPEQSR 211-224
   1765.9240 1765.7693 0 VFLQQQCIPVAMQR 179-192
   1793.8608 1794.8394 0 SQMLQQSICHVMQR 197-210
   2120.0925 2119.0759 1 VFLQQQCIPVAMQRCLAR 179-196
HQ220191 21-1 845.4112 842.5071 0 QTPEQSR 241-247
   878.3971 879.4393 0 QCCQQLR 234-240
   1704.7904 1707.8132 1 QCCQQLRQTPEQSR 234-247
   1765.9240 1765.7466 0 VFLQQQCIPVAMQR 202-215
   1793.8608 1791.7360 0 SQMLQQSICHVMQR 220-233
   2104.0976 2102.0032 1 VFLQQQCIPVAMQRCLAR 202-219
   2342.1501 2342.9780 1 CLARSQMLQQSICHVMQR 216-233
   2643.3044 2643.3130 0 MCSVNVPLYETTTSVPLGVG IGVGAY 342-367
HQ220195 13-1 1479.7662 1482.8090 1 QIPEQSRHESIR 202-213
   1687.9490 1687.8210 0 AIVYSIILQQQQQR 214-227
   1718.8716 1723.8390 0 VFLQQQCIPVEMQR 163-176
   1734.8665 1735.8500 0 VFLQQQCIPVEMQR 163-176
   1823.9295 1828.8950 0 VFLQQQCIPVEMQR 163-176
   2162.1031 2161.0060 1 VFLQQQCIPVEMQRCLAR 163-180
HQ220198 10-1 1593.7876 1595.7630 0 METSCIPGLERPR 1-13
   1850.9404 1851.8900 0 VFLQQQCSPIAMPQR 109-123
   2086.1048 2085.9630 1 VFLQQQCSPIAMPQRLAR 109-126
   2102.0997 2102.0290 1 VFLQQQCSPIAMPQRLAR 109-126
   3337.4388 3337.6920 0 SQMWQQSSCHVMQQQCCQQLQQIPGQSR 127-154
   3960.8448 3963.8230 1 LARSQMWQQSSCHVMQQQCCQQLQQIPGQSR 124-154