Skip to main content

Table 2 Conserved motifs found in ZIFL protein sequences.

From: ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs

Motif Width Assign Amino acid sequence
1 50 MFSa NWPLMSSIILYCVFSFHDMAYSEIFSLWAESDRKYGGLSFSSEDVGQVLA
2 50 MFSa QPAEKYPNVFSEKSIFGRFPYFLPCLCISVFAAVVLISCIWLPETLHKHK
3 41 No hit LPISSLFPFLYFMIRDLHVAKREEDIGFYAGFVGASYMIGR
4 50 MFSa LQNNAVPQDQRGTANGIATTAMSFFKAIAPAGAGVLFSWAQKRQHAAFFP
5 50 MFSa GASLLVYQLFIYPWVHKVLGPINSSRIAAILSIPILCTYPFMTHLSGPWL
6 50 MFSa RFLLGALNGMLGPIKAYSIEVCRPEHQALGLSIVSTAWGIGLVVGPAIGG
7 29 MFSa PVIVFSIFSVVIFNTLFGLSTKYWMAITT
8 21 No hit HDGCPGCAMERRKEEHKGIPY
9 15 MFSa ASIFWGIVADRIGRK
10 28 No hit GDQMVFFMLNVTEVIGLMLTFKPFLAVP
11 21 No hit VLNIASMMKNNLAVTIITGTN
Ab 21 No hit NSVEALEEHLMDPNEEENENE
Bb 15 No hit IKRIKELPSQQAYWD
Cb 11 No hit EELEAQVGGSN
  1. aMFS (Major Facilitator Superfamily Antiporter)
  2. bAnalysis performed with whole set of ZIF proteins (68 sequences)